PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00800.1.p
Common NameEUGRSUZ_K00800, LOC104427157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 727aa    MW: 79852.4 Da    PI: 5.7553
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.8e-2066121156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++e+e++F+++++p+ ++r+eL ++lgL+  qVk+WFqN+R+++k
  Eucgr.K00800.1.p  66 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELGRQLGLEPLQVKFWFQNKRTQMK 121
                       688999***********************************************999 PP

2START221.13.6e-692554751206
                       HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       ela +a++el+++a+++ep+W   +    + +n+de+++ f+++ v     ++ ea+r +gv +m++ +lve+l+d++ qW++ +     +a+
  Eucgr.K00800.1.p 255 ELAVAAMEELIRMAQEGEPMWIAGPdgssSVLNEDEYIRAFPRGIVtnptgFKREASRQTGVIIMNHINLVEILMDVN-QWSTIFSsivsRAM 346
                       57899******************99999999**************9********************************.************** PP

                       EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
             START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                       tlev+s+g      galq+ +ae+q++splvp R+++fvRy++q+++g+w++vdvS+d  +++p     vR+++ pSg+li++++ng+skvtw
  Eucgr.K00800.1.p 347 TLEVLSTGvagnynGALQVVTAEFQVPSPLVPtREVYFVRYCKQHRDGTWAVVDVSLDTLRPNPA----VRCRRKPSGCLIQEMPNGYSKVTW 435
                       ****************************************************************5....************************ PP

                       EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       +ehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Eucgr.K00800.1.p 436 LEHVEVDDRGVHNLYKQLVGSGHAFGAKRWVATLDRQCER 475
                       **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2245121IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1952123IPR009057Homeodomain-like
PROSITE profilePS5007117.03863123IPR001356Homeobox domain
SMARTSM003895.9E-1964127IPR001356Homeobox domain
CDDcd000861.13E-1866124No hitNo description
PfamPF000468.4E-1866121IPR001356Homeobox domain
SuperFamilySSF559614.33E-37246477No hitNo description
PROSITE profilePS5084846.191246478IPR002913START domain
CDDcd088752.04E-129250474No hitNo description
SMARTSM002347.4E-62255475IPR002913START domain
PfamPF018523.4E-59256475IPR002913START domain
Gene3DG3DSA:3.30.530.205.5E-7324457IPR023393START-like domain
SuperFamilySSF559615.43E-26495722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MMDIFQQNLM EGGGGPPLHP LDMVQNPSES ELARLREDDF DSTKSGSDNH EEPPSGDDLQ  60
DERRKKKRYH RHTQHQIQEM EAFFKECPHP DDKQRKELGR QLGLEPLQVK FWFQNKRTQM  120
KTQHERHENT QLRSENEKLR ADNMRYREAL TNASCPNCGG PTAIGEMSFD EHHLRLENAR  180
LREEIDRISA IAAKYVGKPI ANYPLLPSSV PPRPLELGFG SFSGQSGVGG DIYGSGDLFR  240
SIPAPTEAEK PMIIELAVAA MEELIRMAQE GEPMWIAGPD GSSSVLNEDE YIRAFPRGIV  300
TNPTGFKREA SRQTGVIIMN HINLVEILMD VNQWSTIFSS IVSRAMTLEV LSTGVAGNYN  360
GALQVVTAEF QVPSPLVPTR EVYFVRYCKQ HRDGTWAVVD VSLDTLRPNP AVRCRRKPSG  420
CLIQEMPNGY SKVTWLEHVE VDDRGVHNLY KQLVGSGHAF GAKRWVATLD RQCERLASAM  480
ATHIPSGDVG VITSPEGRKS MMKLAERMVI SFCAGVSAST AQTWTTLSGT GADDVRVMTR  540
KSVDDPGRPP GIVLCAATSF WLPVSPKQVF DFLRDENSRS EWDILSNGGI VQEMGHIANG  600
RDTGNCVSLL RVNSANSSQS NMLILQESCT DATGSFVVYA PVDIVAMNVV LNGGDPDYVA  660
LLPSGFSILP DGSQGSGEVA SGGSLLTVAF QILVDSVPTA KLSLGSVATV NNLIACTVER  720
IRASLW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16267RRKKKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010038600.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A058ZZV00.0A0A058ZZV0_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2